Human IL-6 Protein

Cat# BB-PE0150 100µg (1mg/ml) 

Product type: Human interleukin 6 (IL-6) 29-212 aa

Source: Recombinant protein expressed as His Tag protein in E. coli.

Protein Sequence:

VPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNL
PKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQ
KKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM                       

Purity: >98%, by SDS-PAGE under reducing conditions and visualized by coomassie stain

Formulation:           Supplied as a 0.2 μm filtered solution in PBS with 50% Glycerol.

Specificity: Acts both on human and murine cell lines

Description: Interleukin-6 (IL-6) is a 22-28 kDa phosphorylated and variably glycosylated cytokine that plays important roles in the acute phase reaction, inflammation, hematopoiesis and bone metabolism.  Mature human IL-6 is 183 amino acids (aa) in length and shares 39% aa sequence identity with mouse IL-6. Aberrant IL-6 activity contributes to chronic inflammation in obesity, insulin resistance, inflammatory bowel disease, arthritis, sepsis, and atherosclerosis.

Storage instructions: Store at -20°C (Recommended).