Product type: Human Tumor Necrosis Factor alpha (TNF)
extra-cellular domain.

Source: Recombinant protein expressed in E. coli
Other Name: TNFSF1A, TNFSF2
Protein Sequence:
MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSF

LIVAGATTLFCLLHFGVIGPQREESPRDLSLISPLAQAV

RSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANAL

LANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTH

VLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAK

PWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQV

YFGIIAL

Purity: Greater than 98% evaluated based on SDS-PAGE
Formulation: Supplied as a 0.2 μm filtered solution in PBS at 100 μg (1mg/ml) in sterile PBS containing at least 0.1% human or bovine serum albumin.
Specificity: Acts both on human and murine cell lines.

Description: Tumor necrosis factor alpha (TNF-α), is a member of the TNF superfamily. It is a pleiotropic molecule that plays a central role in inflammation and immune system development. TNF-α is produced by a wide variety of cell types including lymphoid cells. TNF matures through separation of the extracellular domain from rest of the molecule. It forms a soluble trimer which binds the trimeric TNF receptor (TNFR). TNF-α is a key cytokine in the development of several inflammatory disorders.
Storage buffer: Phosphate Buffer pH 7.4, containing 50% Glycerol without azide.
Storage instructions: -20°C (Recommended).