Product type: Murine Tumor Necrosis Factor alpha (TNFα) extra-cellular domain.

Source: Recombinant protein expressed in E. coli
Other Name: TNFSF1A, TNFSF2
Protein Sequence:
LRSSSQNSSDKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLVYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVNLLSAVKSPCPKDTPEGAELKPWYEPIYLGGVFQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL

Purity: Greater than 98%

Description: TNFα is acytokine that Tumor necrosis factor alpha (TNF-α), is a member of the TNF superfamily. It is a pleiotropic molecule that plays a central role in inflammation, apoptosis, and immune system development. TNF-α is produced by a wide variety of cell types. Mature extracellular domain of murineTNF-α forms a soluble trimer. TNF-α trimers bind the ubiquitous TNF RI and the hematopoietic cell-restricted TNF RII, both of which are also expressed as homotrimers. TNF-α is a key cytokine in the development of several inflammatory disorders.

Specificity: Acts both on human and murine cell lines.

Storage instructions: Store at -20°C (Recommended).