Mouse-TNFα
Cat# BB-PE0175 100µg (1mg/ml)
Product type: Murine TNFα extracellular domain
Source: Recombinant protein expressed in E. coli
Other Name: TNFSF1A, TNFSF2
Protein Sequence:
LRSSSQNSSDKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLVY
SQVLFKGQGCPDYVLLTHTVSRFAISYQEKVNLLSAVKSPCPKDTPEGAELKPWYEPIYLGGV
FQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL
Purity: Greater than 98%
Description: Tumor necrosis factor alpha (TNF-α) is a member of the TNF superfamily. It is a pleiotropic molecule that plays a central role in inflammation, apoptosis, and immune system development. TNF-α is produced by a wide variety of cell types. Mature extracellular domain of murineTNF-α forms a soluble trimer. TNF-α trimers bind the ubiquitous TNF RI and the hematopoietic cell-restricted TNF RII, both of which are also expressed as homotrimers. TNF-α is a key cytokine in the development of several inflammatory disorders.
Specificity: Acts both on human and murine cell lines
Storage buffer: Tris Buffer pH 7.4, containing 50% Glycerol without azide.
Storage: Store at -20°C (Recommended).
* Exp. Date: 12 months upon receiving at proper storage condition as mentioned in datasheet. |

Address
EN-35, First floor, Salt Lake, Sector - V, Kolkata - 700091, West Bengal, INDIA
Call Us
+91 33 40077640
+91 9836508080