Mouse-TNFα  

Cat# BB-PE0175 100µg (1mg/ml) 

Product type: Murine TNFα extracellular domain

Source: Recombinant protein expressed in E. coli

Other Name: TNFSF1A, TNFSF2

Protein Sequence:

LRSSSQNSSDKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLVY
SQVLFKGQGCPDYVLLTHTVSRFAISYQEKVNLLSAVKSPCPKDTPEGAELKPWYEPIYLGGV
FQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL

Purity: Greater than 98%

Description: Tumor necrosis factor alpha (TNF-α) is a member of the TNF superfamily. It is a pleiotropic molecule that plays a central role in inflammation, apoptosis, and immune system development. TNF-α is produced by a wide variety of cell types. Mature extracellular domain of murineTNF-α forms a soluble trimer. TNF-α trimers bind the ubiquitous TNF RI and the hematopoietic cell-restricted TNF RII, both of which are also expressed as homotrimers. TNF-α is a key cytokine in the development of several inflammatory disorders.

Specificity: Acts both on human and murine cell lines

Storage buffer: Tris Buffer pH 7.4, containing 50% Glycerol without azide.

Storage: Store at -20°C (Recommended).

* Exp. Date: 12 months upon receiving at proper storage condition as mentioned in datasheet.

Address

EN-35, First floor, Salt Lake, Sector - V, Kolkata - 700091, West Bengal, INDIA

Call Us

+91 33 40077640
+91 9836508080

Scroll to Top