Human IL-6 Protein
Cat# BB-PE0150 100µg (1mg/ml)
Product type: Human interleukin 6 (IL-6) 29-212 aa
Source: Recombinant protein expressed as His Tag protein in E. coli.
Protein Sequence:
VPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNL
PKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQ
KKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Purity: >98%, by SDS-PAGE under reducing conditions and visualized by coomassie stain
Formulation: Supplied as a 0.2 μm filtered solution in PBS with 50% Glycerol.
Specificity: Acts both on human and murine cell lines
Description: Interleukin-6 (IL-6) is a 22-28 kDa phosphorylated and variably glycosylated cytokine that plays important roles in the acute phase reaction, inflammation, hematopoiesis and bone metabolism. Mature human IL-6 is 183 amino acids (aa) in length and shares 39% aa sequence identity with mouse IL-6. Aberrant IL-6 activity contributes to chronic inflammation in obesity, insulin resistance, inflammatory bowel disease, arthritis, sepsis, and atherosclerosis.
Storage instructions: Store at -20°C (Recommended).
* Exp. Date: 18 months upon receiving at proper storage condition as mentioned in datasheet. |

Address
EN-35, First floor, Salt Lake, Sector - V, Kolkata - 700091, West Bengal, INDIA
Call Us
+91 33 40077640
+91 9836508080