bbioladmin

pBBL-kBLuc

pBBL-kBLuc Cat#BB-V0035 (10µg) Description: pBBL-kBLuc plasmid expresses luciferase in mammalian cell driven by the NF-kB family of dimeric transcription factors. The plasmid is ampicillin resistant and amplified in E. coli. The sequence of the binding site is GGGACTTTCC GCTG GGGACTTTCC which is cloned at SalI-BamHI site. Download PDF Address EN-35, First floor, Salt Lake, Sector

pBBL-kBLuc Read More »

pUC19

pUC19 Cat#BB-V0011 (10µg) Description:  pUC19 is a double stranded circular E. Coli cloning vector having 2686bp. pUC19 carries the ampicillin resistance gene. Storage:  -20OC Download PDF Address EN-35, First floor, Salt Lake, Sector – V, Kolkata – 700091, West Bengal, INDIA Call Us +91 33 40077640 +91 9836508080 Email Us [email protected]

pUC19 Read More »

pUC18

pUC18 Cat#BB-V0010 (10µg) Description:  pUC18 is a double stranded circular E. Coli cloning vector having 2686bp. pUC18 carries the ampicillin resistance gene. Storage:  -20OC Download PDF Address EN-35, First floor, Salt Lake, Sector – V, Kolkata – 700091, West Bengal, INDIA Call Us +91 33 40077640 +91 9836508080 Email Us [email protected]

pUC18 Read More »

pBBL-TA Vector (Linearized)

pBBL-TA Vector (Linearized) Cat#BB-V0005 (10µg) Description:  This is a modified pUC vector (pUC18) used for the cloning of PCR fragment with ‘A’ overhang at 3’ end. This vector contain Ampicillin resistant gene. DH5α strain should be transformed with the clone. For clone confirmation M13 Sequencing Primer is to be used. Download PDF Address EN-35, First

pBBL-TA Vector (Linearized) Read More »

pHis-TEV-EGFP Vector

pHis-TEV-EGFP Vector Cat#BB-V0020E (10µg) Description:  This is a modified pET vector (pET21d) used for the expression of N-terminal His-GFP tagged protein in E.coli. The vector contains N-terminal 6X His-TEV–GFP site. Ampicillin is the selective marker for the vector. Storage: – 200C Download PDF Address EN-35, First floor, Salt Lake, Sector – V, Kolkata – 700091,

pHis-TEV-EGFP Vector Read More »

pFLAG-TEV Vector

pFLAG-TEV Vector Cat#BB-V0022 (10µg) Description: This is a modified pET vector (pET 29b) used for the expression of N terminal Flag tagged and C-terminal His tagged protein in E.coli. The FLAG tag is cleavable with TEV protease. This vector contains Kanamycin resistant gene. Storage at -200C.   Download PDF Address EN-35, First floor, Salt Lake,

pFLAG-TEV Vector Read More »

Protein Human IL-1β

Protein Human IL-1β Cat# BB-PE0155 100µg (1mg/ml)    Product type: Human interleukin 1beta (IL-1β) Source: Recombinant protein expressed in E. coli Protein Sequence: APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLFESAQFPNWYISTSQAENM PVFLGGTKGGQDITDFTMQFVSS Purity: >98%, by SDS-PAGE under reducing conditions and visualized by coomassie stain. Formulation: Supplied as a 0.2 μm filtered solution in PBS at 100 μg(1mg/ml) in sterile PBS containing 50% Glycerol.

Protein Human IL-1β Read More »

Phosphate buffered saline (PBS)

Phosphate buffered saline (PBS) (10X)   Cat# BB-BS25 (500ml)   Description: BBL-PBS (phosphate buffered saline) is a pH-adjusted blend of ultrapure-grade phosphate buffers and saline solutions. Each 10X PBS solution is ready to use upon dilution to the desired concentration. This molecular biology-grade PBS is certified RNase-free; it is rigorously tested for contaminating nonspecific endonuclease, exonuclease,

Phosphate buffered saline (PBS) Read More »

Scroll to Top