Products

BL21 (DE3) Rosetta Competent Cells

BL21 (DE3) Rosetta Competent Cells Cat# BB-X0054 (100 µl X 5 Vials) Description: Highly efficient (106 – 107cfu per µg DNA) BL21 (DE3) Rosetta competent cells are used to transform ligation mixture. Be extremely gentle when working with competent cells. Competent cells are highly sensitive to changes in temperature or mechanical lysis caused by pipetting.

BL21 (DE3) Rosetta Competent Cells Read More »

100mM ATP

100mM ATP Cat # BB-C0030 (250μl) Product description: Adenosine-5′-triphosphate (ATP) disodium salt supplied as 100mM aqueous solution. ATP is DNase, RNase free and more than 99% pure. Application: This product is suitable for use in all standard and highly sensitive PCR techniques and other biological research works. Storage: –20°C Download PDF Address EN-35, First floor,

100mM ATP Read More »

IPTG (Molecular Biology Grade)

IPTG (Molecular Biology Grade) Cat# BB-C0010 (5gm)   Description: IPTG (isopropyl-beta-D-thiogalactopyranoside) is a highly stable synthetic analog of lactose is used for the induction of gene expression under control of the lac promoter. This dioxane free crystalline solid isopropyl-β-d-thiogalactopyranoside is more than 99% pure. Store at: –20 ºC. Download PDF Download MSDS Address EN-35, First

IPTG (Molecular Biology Grade) Read More »

ECL Reagent

ECL Reagent Cat# BB-C0015 (100 reactions) Description: Biobharati ECL Western Blotting detection reagent is a highly sensitive nonradioactive, enhanced luminol-based chemiluminescent substrate for the detection of horseradish peroxidase (HRP) on immunoblots. BBL ECL Western Blotting Substrate enables the detection of picogram amounts of antigen and allows for easy detection of HRP using photographic or electronic

ECL Reagent Read More »

Human IL-6 Protein

Human IL-6 Protein Cat# BB-PE0150 100µg (1mg/ml)  Product type: Human interleukin 6 (IL-6) 29-212 aa Source: Recombinant protein expressed as His Tag protein in E. coli. Protein Sequence: VPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM                        Purity: >98%, by SDS-PAGE under reducing conditions and visualized by coomassie stain Formulation:           Supplied as a 0.2 μm filtered solution in PBS with 50% Glycerol.

Human IL-6 Protein Read More »

Tris-buffered saline (TBS) (10X)

Tris-buffered saline (TBS)(10X)  Cat# BB-BS35 (500ml) Description: BBL-TRIS-buffered saline (TBS, 10X) is a common pH-stabilizing biological buffer due to its low toxicity. TBS is an excellent wash buffer for many immunoassays, including protein purification, Western blot, and ELISA. TBS buffer interacts favorably with antibodies and is commonly used in immunoassay and immunostaining procedures, such as

Tris-buffered saline (TBS) (10X) Read More »

Scroll to Top